SCOPe 2.01: Domain d1xpya2: 1xpy A:6-132

Lineage for d1xpya2 (1xpy A:6-132)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein N-acylamino acid racemase [110937] (4 species)

7. Species Deinococcus radiodurans [TaxId:1299] [110939] (4 PDB entries)
   Uniprot Q9RYA6

8. Domain d1xpya2: 1xpy A:6-132 [115811]
   Other proteins in same PDB: d1xpya1, d1xpyb1, d1xpyc1, d1xpyd1
   complexed with mg, nlq

Details for d1xpya2

PDB Entry: 1xpy, 2.3 Å

PDB Description: Structural Basis for Catalytic Racemization and Substrate Specificity of an N-Acylamino Acid Racemase Homologue from Deinococcus radiodurans

PDB Compounds: (A:) N-acylamino acid racemase

SCOPe Domain Sequences for d1xpya2:

Sequence, based on SEQRES records:

>d1xpya2 d.54.1.1 (A:6-132) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]}
rmfkieaaeivvarlplkfrfetsfgvqthkvvpllilhgegvqgvaegtmearpmyree
tiagaldllrgtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwartlgvp
lgtllgg

Sequence, based on observed residues (ATOM records):

>d1xpya2 d.54.1.1 (A:6-132) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]}
rmfkieaaeivvarlplkthkvvpllilhgegvqgvaegtmearpmyreetiagaldllr
gtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwartlgvplgtllgg

Timeline for d1xpya2:

• d1xpya2 first appeared in SCOP 1.71
  
• d1xpya2 appears in SCOP 1.75
  
• d1xpya2 appears in SCOPe 2.02
  
• d1xpya2 appears in the current release, SCOPe 2.08