Lineage for d1xpya2 (1xpy A:6-132)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1025940Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1025941Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 1025942Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 1026124Protein N-acylamino acid racemase [110937] (4 species)
  7. 1026142Species Deinococcus radiodurans [TaxId:1299] [110939] (4 PDB entries)
    Uniprot Q9RYA6
  8. 1026148Domain d1xpya2: 1xpy A:6-132 [115811]
    Other proteins in same PDB: d1xpya1, d1xpyb1, d1xpyc1, d1xpyd1
    complexed with mg, nlq

Details for d1xpya2

PDB Entry: 1xpy (more details), 2.3 Å

PDB Description: Structural Basis for Catalytic Racemization and Substrate Specificity of an N-Acylamino Acid Racemase Homologue from Deinococcus radiodurans
PDB Compounds: (A:) N-acylamino acid racemase

SCOPe Domain Sequences for d1xpya2:

Sequence, based on SEQRES records: (download)

>d1xpya2 d.54.1.1 (A:6-132) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]}
rmfkieaaeivvarlplkfrfetsfgvqthkvvpllilhgegvqgvaegtmearpmyree
tiagaldllrgtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwartlgvp
lgtllgg

Sequence, based on observed residues (ATOM records): (download)

>d1xpya2 d.54.1.1 (A:6-132) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]}
rmfkieaaeivvarlplkthkvvpllilhgegvqgvaegtmearpmyreetiagaldllr
gtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwartlgvplgtllgg

SCOPe Domain Coordinates for d1xpya2:

Click to download the PDB-style file with coordinates for d1xpya2.
(The format of our PDB-style files is described here.)

Timeline for d1xpya2: