![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
![]() | Protein Hypothetical protein XCC2852 [110606] (1 species) |
![]() | Species Xanthomonas campestris [TaxId:339] [110607] (2 PDB entries) Uniprot Q8P6W3 |
![]() | Domain d1xpva_: 1xpv A: [115808] Structural genomics target |
PDB Entry: 1xpv (more details)
SCOPe Domain Sequences for d1xpva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xpva_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} maltlyqrddchlcdqavealaqaragaffsvfidddaalesayglrvpvlrdpmgreld wpfdaprlrawldaapha
Timeline for d1xpva_: