Lineage for d1xpva_ (1xpv A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876167Protein Hypothetical protein XCC2852 [110606] (1 species)
  7. 2876168Species Xanthomonas campestris [TaxId:339] [110607] (2 PDB entries)
    Uniprot Q8P6W3
  8. 2876170Domain d1xpva_: 1xpv A: [115808]
    Structural genomics target

Details for d1xpva_

PDB Entry: 1xpv (more details)

PDB Description: solution structure of northeast structural genomics target protein xcr50 from x. campestris
PDB Compounds: (A:) hypothetical protein XCC2852

SCOPe Domain Sequences for d1xpva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xpva_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]}
maltlyqrddchlcdqavealaqaragaffsvfidddaalesayglrvpvlrdpmgreld
wpfdaprlrawldaapha

SCOPe Domain Coordinates for d1xpva_:

Click to download the PDB-style file with coordinates for d1xpva_.
(The format of our PDB-style files is described here.)

Timeline for d1xpva_: