PDB entry 1xpv

View 1xpv on RCSB PDB site
Description: Solution Structure of Northeast Structural Genomics Target Protein XcR50 from X. Campestris
Class: Structural genomics, unknown function
Keywords: ALPHA+BETA, GFT NMR, Structural Genomics, NESGC, XcR50, protein structure initiative, PSI, Northeast Structural Genomics Consortium, unknown function
Deposited on 2004-10-09, released 2004-12-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein XCC2852
  Species: Xanthomonas campestris [TaxId:339]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8P6W3 (0-77)
  Domains in SCOPe 2.08: d1xpva_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xpvA (A:)
  maltlyqrddchlcdqavealaqaragaffsvfidddaalesayglrvpvlrdpmgreld
  wpfdaprlrawldaapha