SCOPe 2.06: Domain d1xp5a1: 1xp5 A:125-239

Lineage for d1xp5a1 (1xp5 A:125-239)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.7: Metal cation-transporting ATPase, actuator domain A [81653] (1 family)
   a distorted variant of double-helix

5. Family b.82.7.1: Metal cation-transporting ATPase, actuator domain A [81652] (2 proteins)

6. Protein Calcium ATPase, transduction domain A [81651] (1 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (43 PDB entries)
   Uniprot P04191

8. Domain d1xp5a1: 1xp5 A:125-239 [115730]
   Other proteins in same PDB: d1xp5a2, d1xp5a3, d1xp5a4
   complexed with alf, k, mg, tg1

Details for d1xp5a1

PDB Entry: 1xp5, 3 Å

PDB Description: Structure Of The (Sr)Ca2+-ATPase E2-AlF4- Form

PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d1xp5a1:

Sequence; same for both SEQRES and ATOM records:

>d1xp5a1 b.82.7.1 (A:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges
vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm

Timeline for d1xp5a1:

• d1xp5a1 first appeared in SCOP 1.71
  
• d1xp5a1 appears in SCOPe 2.05
  
• d1xp5a1 appears in SCOPe 2.07
  
• d1xp5a1 appears in the current release, SCOPe 2.08