SCOP 1.73: Domain d1xo7a_: 1xo7 A:

Lineage for d1xo7a_ (1xo7 A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (3 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (12 proteins)

6. Protein Cyclophilin (eukaryotic) [50893] (13 species)

7. Species Trypanosoma cruzi [TaxId:5693] [117269] (2 PDB entries)

8. Domain d1xo7a_: 1xo7 A: [115694]

Details for d1xo7a_

PDB Entry: 1xo7, 1.61 Å

PDB Description: Crystal structure of cyclophilin from Trypanosoma cruzi

PDB Compounds: (A:) cyclophilin

SCOP Domain Sequences for d1xo7a_:

Sequence; same for both SEQRES and ATOM records:

>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]}
mpvvtdkvyfditigdepvgrvviglfgndvpktvenfkqlasgengfgykgsifhrvir
nfmiqggdftnfdgtggksiygtrfddenlkikhfvgavsmanagpnsngsqffvttapt
pwldgrhvvfgkvvegmdvvkkventktglndkpkkavkindcgvl

Timeline for d1xo7a_:

• d1xo7a_ first appeared in SCOP 1.71
  
• d1xo7a_ appears in SCOP 1.75
  
• d1xo7a_ appears in the current release, SCOPe 2.08