![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (9 proteins) Pfam PF01039 the active site is formed by two different homologous subunits or domains of this fold |
![]() | Protein Propionyl-CoA carboxylase complex B subunit, PccB [117466] (3 species) |
![]() | Species Streptomyces coelicolor [TaxId:1902] [117467] (4 PDB entries) Uniprot Q9X4K7 |
![]() | Domain d1xo6a1: 1xo6 A:10-267 [115682] |
PDB Entry: 1xo6 (more details), 2.2 Å
SCOPe Domain Sequences for d1xo6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xo6a1 c.14.1.4 (A:10-267) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} dihttagkladlrrrieeathagsaravekqhakgkltareridllldegsfveldefar hrstnfgldanrpygdgvvtgygtvdgrpvavfsqdftvfggalgevygqkivkvmdfal ktgcpvvgindsggariqegvaslgaygeifrrnthasgvipqislvvgpcaggavyspa itdftvmvdqtshmfitgpdviktvtgedvgfeelggarthnstsgvahhmagdekdave yvkqllsylpsnnlsepp
Timeline for d1xo6a1: