Lineage for d1xo6b1 (1xo6 B:10-267)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853345Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (9 proteins)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 2853452Protein Propionyl-CoA carboxylase complex B subunit, PccB [117466] (3 species)
  7. 2853466Species Streptomyces coelicolor [TaxId:1902] [117467] (4 PDB entries)
    Uniprot Q9X4K7
  8. 2853469Domain d1xo6b1: 1xo6 B:10-267 [115684]

Details for d1xo6b1

PDB Entry: 1xo6 (more details), 2.2 Å

PDB Description: Acyl-CoA Carboxylase Beta Subunit from S. coelicolor (PccB), apo form #3
PDB Compounds: (B:) propionyl-CoA carboxylase complex B subunit

SCOPe Domain Sequences for d1xo6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xo6b1 c.14.1.4 (B:10-267) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]}
dihttagkladlrrrieeathagsaravekqhakgkltareridllldegsfveldefar
hrstnfgldanrpygdgvvtgygtvdgrpvavfsqdftvfggalgevygqkivkvmdfal
ktgcpvvgindsggariqegvaslgaygeifrrnthasgvipqislvvgpcaggavyspa
itdftvmvdqtshmfitgpdviktvtgedvgfeelggarthnstsgvahhmagdekdave
yvkqllsylpsnnlsepp

SCOPe Domain Coordinates for d1xo6b1:

Click to download the PDB-style file with coordinates for d1xo6b1.
(The format of our PDB-style files is described here.)

Timeline for d1xo6b1: