![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.3: MoaD/ThiS [54285] (5 families) ![]() possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies |
![]() | Family d.15.3.3: C9orf74 homolog [117833] (1 protein) automatically mapped to Pfam PF09138 |
![]() | Protein C9orf74 homolog [117834] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [117835] (2 PDB entries) Uniprot Q9D2P4 # |
![]() | Domain d1xo3a1: 1xo3 A:2-101 [115678] Other proteins in same PDB: d1xo3a2 Structural genomics target |
PDB Entry: 1xo3 (more details)
SCOPe Domain Sequences for d1xo3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xo3a1 d.15.3.3 (A:2-101) C9orf74 homolog {Mouse (Mus musculus) [TaxId: 10090]} aaplcvkvefgggaellfdgvkkhqvalpgqeepwdirnllvwikknllkerpelfiqgd svrpgilvlindadwellgeldyqlqdqdsilfistlhgg
Timeline for d1xo3a1: