PDB entry 1xo3

View 1xo3 on RCSB PDB site
Description: Solution Structure of Ubiquitin like protein from Mus Musculus
Class: structural genomics, unknown function
Keywords: Structural Genomics, Protein Structure Initiative, Center for Eukaryotic Structural Genomics, PSI, CESG, UNKNOWN FUNCTION
Deposited on 2004-10-05, released 2004-10-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RIKEN cDNA 2900073H19
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9D2P4 (1-100)
    • cloning artifact (0)
  Domains in SCOPe 2.08: d1xo3a1, d1xo3a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xo3A (A:)
  saaplcvkvefgggaellfdgvkkhqvalpgqeepwdirnllvwikknllkerpelfiqg
  dsvrpgilvlindadwellgeldyqlqdqdsilfistlhgg