Lineage for d1xnxa_ (1xnx A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 776482Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 776483Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 776484Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 proteins)
  6. 776717Protein Orphan nuclear receptor NR1I3 (CAR) [117014] (2 species)
  7. 776723Species Mouse (Mus musculus) [TaxId:10090] [117015] (2 PDB entries)
    Uniprot O35627 109-358
  8. 776724Domain d1xnxa_: 1xnx A: [115667]

Details for d1xnxa_

PDB Entry: 1xnx (more details), 2.9 Å

PDB Description: crystal structure of constitutive androstane receptor
PDB Compounds: (A:) constitutive androstane receptor

SCOP Domain Sequences for d1xnxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnxa_ a.123.1.1 (A:) Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus musculus) [TaxId: 10090]}
lqlnqqqkelvqillgahtrhvgplfdqfvqfkppaylfmhhrpfqprgpvlpllthfad
intfmvqqiikftkdlplfrsltmedqisllkgaaveilhislnttfclqtenffcgplc
ykmedavhagfqyeflesilhfhknlkglhlqepeyvlmaatalfspdrpgvtqreeidq
lqeemalilnnhimeqqsrlqsrflyaklmglladlrsinnaysyelqrlee

SCOP Domain Coordinates for d1xnxa_:

Click to download the PDB-style file with coordinates for d1xnxa_.
(The format of our PDB-style files is described here.)

Timeline for d1xnxa_: