Lineage for d1xnsb1 (1xns B:20-129)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493397Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1494115Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (2 families) (S)
  5. 1494116Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins)
  6. 1494117Protein Cre recombinase [47825] (1 species)
  7. 1494118Species Bacteriophage P1 [TaxId:10678] [47826] (20 PDB entries)
    Uniprot P06956 20-341
  8. 1494146Domain d1xnsb1: 1xns B:20-129 [115649]
    Other proteins in same PDB: d1xnsa2, d1xnsb2
    protein/DNA complex

Details for d1xnsb1

PDB Entry: 1xns (more details), 2.8 Å

PDB Description: Peptide trapped Holliday junction intermediate in Cre-loxP recombination
PDB Compounds: (B:) Recombinase cre

SCOPe Domain Sequences for d1xnsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnsb1 a.60.9.1 (B:20-129) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq
arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage

SCOPe Domain Coordinates for d1xnsb1:

Click to download the PDB-style file with coordinates for d1xnsb1.
(The format of our PDB-style files is described here.)

Timeline for d1xnsb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xnsb2