![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins) barrel, closed; n=5, S=8 |
![]() | Protein Ribosomal protein S17 [50304] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [50305] (45 PDB entries) Uniprot P24321 |
![]() | Domain d1xnqq_: 1xnq Q: [115620] Other proteins in same PDB: d1xnqb_, d1xnqc1, d1xnqc2, d1xnqd_, d1xnqe1, d1xnqe2, d1xnqf_, d1xnqg_, d1xnqh_, d1xnqi_, d1xnqj_, d1xnqk_, d1xnql_, d1xnqm_, d1xnqn_, d1xnqo_, d1xnqp_, d1xnqr_, d1xnqs_, d1xnqt_, d1xnqv_ complexed with mg, par, zn has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1xnq (more details), 3.05 Å
SCOPe Domain Sequences for d1xnqq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xnqq_ b.40.4.5 (Q:) Ribosomal protein S17 {Thermus thermophilus [TaxId: 274]} pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka
Timeline for d1xnqq_: