![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families) ![]() |
![]() | Family c.23.8.1: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52256] (2 proteins) automatically mapped to Pfam PF00731 |
![]() | Protein N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52257] (4 species) |
![]() | Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [117479] (1 PDB entry) Uniprot Q81ZH8 |
![]() | Domain d1xmpc1: 1xmp C:-5-156 [115523] Other proteins in same PDB: d1xmpc2, d1xmpg2 |
PDB Entry: 1xmp (more details), 1.8 Å
SCOPe Domain Sequences for d1xmpc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xmpc1 c.23.8.1 (C:-5-156) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} hhhhhhmkslvgvimgstsdwetmkyacdildelnipyekkvvsahrtpdymfeyaetar erglkviiagaggaahlpgmvaaktnlpvigvpvqskalngldsllsivqmpggvpvatv aigkagstnagllaaqilgsfhddihdalelrreaiekdvre
Timeline for d1xmpc1: