Lineage for d1xmpe_ (1xmp E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857183Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families) (S)
  5. 2857184Family c.23.8.1: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52256] (2 proteins)
    automatically mapped to Pfam PF00731
  6. 2857185Protein N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52257] (4 species)
  7. 2857209Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [117479] (1 PDB entry)
    Uniprot Q81ZH8
  8. 2857214Domain d1xmpe_: 1xmp E: [115525]
    Other proteins in same PDB: d1xmpc2, d1xmpg2

Details for d1xmpe_

PDB Entry: 1xmp (more details), 1.8 Å

PDB Description: Crystal Structure of PurE (BA0288) from Bacillus anthracis at 1.8 Resolution
PDB Compounds: (E:) phosphoribosylaminoimidazole carboxylase

SCOPe Domain Sequences for d1xmpe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmpe_ c.23.8.1 (E:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
kslvgvimgstsdwetmkyacdildelnipyekkvvsahrtpdymfeyaetarerglkvi
iagaggaahlpgmvaaktnlpvigvpvqskalngldsllsivqmpggvpvatvaigkags
tnagllaaqilgsfhddihdalelrreaiekdvre

SCOPe Domain Coordinates for d1xmpe_:

Click to download the PDB-style file with coordinates for d1xmpe_.
(The format of our PDB-style files is described here.)

Timeline for d1xmpe_: