SCOPe 2.07: Domain d1xmda1: 1xmd A:11-392

Lineage for d1xmda1 (1xmd A:11-392)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
   core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest

4. Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families)

5. Family c.43.1.3: Choline/Carnitine O-acyltransferase [82424] (3 proteins)
   Pfam PF00755; monomeric enzyme containing tandem repeat of two CAT subunit-like domains

6. Protein Peroxisomal carnitine O-octanoyltransferase, COT [117575] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117576] (4 PDB entries)
   Uniprot Q9DC50 11-612

8. Domain d1xmda1: 1xmd A:11-392 [115485]
   complexed with epe, mpd; mutant

Details for d1xmda1

PDB Entry: 1xmd, 2.1 Å

PDB Description: m335v mutant structure of mouse carnitine octanoyltransferase

PDB Compounds: (A:) Peroxisomal carnitine O-octanoyltransferase

SCOPe Domain Sequences for d1xmda1:

Sequence; same for both SEQRES and ATOM records:

>d1xmda1 c.43.1.3 (A:11-392) Peroxisomal carnitine O-octanoyltransferase, COT {Mouse (Mus musculus) [TaxId: 10090]}
ertfqyqdslpslpvpaleeslkkylesvkpfanedeykkteeivqkfqegagkrlhqkl
lerargkrnwleewwlnvayldvripsqlnvnfvgpcphfehywparegtqlergsmmlw
hnlnywqllrreklpvhksgntpldmnqfrmlfstckvpgitrdsimnyfkteseghcpt
hiavlcrgrafvfdvlhegclitppellrqltyihkkcsnepvgpsiaaltseertrwak
areylisldpenltllekiqtslfvysiedssphatpeeysqvfemllggdpsvrwgdks
ynlisfangifgcccdhapydamvvvniahyvdervletegrwkgsekvrdiplpeelvf
tvdekilndvsqakaqhlkaas

Timeline for d1xmda1:

• d1xmda1 first appeared in SCOP 1.71
  
• d1xmda1 appears in SCOPe 2.06
  
• d1xmda1 appears in the current release, SCOPe 2.08