SCOPe 2.05: Domain d1xmba2: 1xmb A:216-334

Lineage for d1xmba2 (1xmb A:216-334)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.19: Bacterial exopeptidase dimerisation domain [55031] (1 family)

5. Family d.58.19.1: Bacterial exopeptidase dimerisation domain [55032] (8 proteins)

6. Protein IAA-amino acid hydrolase [117979] (1 species)
   apparently monomeric

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117980] (2 PDB entries)
   Uniprot P54970 37-428

8. Domain d1xmba2: 1xmb A:216-334 [115480]
   Other proteins in same PDB: d1xmba1
   structural genomics target

Details for d1xmba2

PDB Entry: 1xmb, 2 Å

PDB Description: x-ray structure of iaa-aminoacid hydrolase from arabidopsis thaliana gene at5g56660

PDB Compounds: (A:) IAA-amino acid hydrolase homolog 2

SCOPe Domain Sequences for d1xmba2:

Sequence, based on SEQRES records:

>d1xmba2 d.58.19.1 (A:216-334) IAA-amino acid hydrolase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
agagvfeavitgkgghaaipqhtidpvvaassivlslqqlvsretdpldskvvtvskvng
gnafnvipdsitiggtlraftgftqlqqrvkevitkqaavhrcnasvnltpngrepmpp

Sequence, based on observed residues (ATOM records):

>d1xmba2 d.58.19.1 (A:216-334) IAA-amino acid hydrolase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
agagvfeavitgktidpvvaassivlslqqlvsretdpldskvvtvskvnpdsitiggtl
raftgftqlqqrvkevitkqaavhrcnasvnltpngrepmpp

Timeline for d1xmba2:

• d1xmba2 first appeared in SCOP 1.71
  
• d1xmba2 appears in SCOPe 2.04
  
• d1xmba2 appears in SCOPe 2.06
  
• d1xmba2 appears in the current release, SCOPe 2.08