SCOPe 2.07: Domain d1xm4a_: 1xm4 A:

Lineage for d1xm4a_ (1xm4 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b [48549] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48550] (31 PDB entries)
   Uniprot Q07343 324-667

8. Domain d1xm4a_: 1xm4 A: [115465]
   complexed with mg, pil, zn

Details for d1xm4a_

PDB Entry: 1xm4, 2.31 Å

PDB Description: Catalytic Domain Of Human Phosphodiesterase 4B In Complex With Piclamilast

PDB Compounds: (A:) cAMP-specific 3',5'-cyclic phosphodiesterase 4B

SCOPe Domain Sequences for d1xm4a_:

Sequence; same for both SEQRES and ATOM records:

>d1xm4a_ a.211.1.2 (A:) Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b {Human (Homo sapiens) [TaxId: 9606]}
edhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissdtfitymmt
ledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaihdvdhpgvs
nqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtlrkmvidmv
latdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadlsnptkslel
yrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhplwetwadlv
qpdaqdildtlednrnwyqsmip

Timeline for d1xm4a_:

• d1xm4a_ first appeared in SCOP 1.71
  
• d1xm4a_ appears in SCOPe 2.06
  
• d1xm4a_ appears in the current release, SCOPe 2.08