Lineage for d1xlse_ (1xls E:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 776482Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 776483Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 776484Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 proteins)
  6. 776717Protein Orphan nuclear receptor NR1I3 (CAR) [117014] (2 species)
  7. 776723Species Mouse (Mus musculus) [TaxId:10090] [117015] (2 PDB entries)
    Uniprot O35627 109-358
  8. 776726Domain d1xlse_: 1xls E: [115451]
    Other proteins in same PDB: d1xlsa_, d1xlsb_, d1xlsc_, d1xlsd_

Details for d1xlse_

PDB Entry: 1xls (more details), 2.96 Å

PDB Description: crystal structure of the mouse car/rxr lbd heterodimer bound to tcpobop and 9cra and a tif2 peptide containg the third lxxll motifs
PDB Compounds: (E:) Orphan nuclear receptor NR1I3

SCOP Domain Sequences for d1xlse_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xlse_ a.123.1.1 (E:) Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus musculus) [TaxId: 10090]}
nqqqkelvqillgahtrhvgplfdqfvqfrppaylfmhhrpfqprgpvlpllthfadint
fmvqqiikftkdlplfrsltmedqisllkgaaveilhislnttfclqtenffcgplcykm
edavhagfqyeflesilhfhknlkglhlqepeyvlmaatalfspdrpgvtqreeidqlqe
emalilnnhimeqqsrlqsrflyaklmglladlrsinnaysyelqrleelsamtpllgei
cs

SCOP Domain Coordinates for d1xlse_:

Click to download the PDB-style file with coordinates for d1xlse_.
(The format of our PDB-style files is described here.)

Timeline for d1xlse_: