SCOPe 2.07: Domain d1xl8b2: 1xl8 B:393-610

Lineage for d1xl8b2 (1xl8 B:393-610)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
   core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest

4. Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families)

5. Family c.43.1.3: Choline/Carnitine O-acyltransferase [82424] (3 proteins)
   Pfam PF00755; monomeric enzyme containing tandem repeat of two CAT subunit-like domains

6. Protein Peroxisomal carnitine O-octanoyltransferase, COT [117575] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117576] (4 PDB entries)
   Uniprot Q9DC50 11-612

8. Domain d1xl8b2: 1xl8 B:393-610 [115445]
   complexed with 152, mpd, ocb

Details for d1xl8b2

PDB Entry: 1xl8, 2.2 Å

PDB Description: Crystal structure of mouse carnitine octanoyltransferase in complex with octanoylcarnitine

PDB Compounds: (B:) Peroxisomal carnitine O-octanoyltransferase

SCOPe Domain Sequences for d1xl8b2:

Sequence; same for both SEQRES and ATOM records:

>d1xl8b2 c.43.1.3 (B:393-610) Peroxisomal carnitine O-octanoyltransferase, COT {Mouse (Mus musculus) [TaxId: 10090]}
dlqiaastftsfgkkltkeealhpdtfiqlalqlayyrlhgrpgccyetamtryfyhgrt
etvrsctveavrwcqsmqdpsasllerqqkmleafakhnkmmkdcshgkgfdrhllglll
iakeeglpvpelfedplfsrsggggnfvlstslvgylrvqgvvvpmvhngygffyhirdd
rfvvacsswrscpetdaeklvqmifhafhdmiqlmnta

Timeline for d1xl8b2:

• d1xl8b2 first appeared in SCOP 1.71
  
• d1xl8b2 appears in SCOPe 2.06
  
• d1xl8b2 appears in the current release, SCOPe 2.08