Lineage for d1xjta_ (1xjt A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 714012Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 714013Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 714660Family d.2.1.3: Phage lysozyme [53981] (3 proteins)
  6. 714661Protein Endolysin Lyz [117758] (1 species)
  7. 714662Species Bacteriophage P1 [TaxId:10678] [117759] (2 PDB entries)
  8. 714665Domain d1xjta_: 1xjt A: [115393]
    complexed with cit

Details for d1xjta_

PDB Entry: 1xjt (more details), 1.75 Å

PDB Description: crystal structure of active form of p1 phage endolysin lyz
PDB Compounds: (A:) lysozyme

SCOP Domain Sequences for d1xjta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xjta_ d.2.1.3 (A:) Endolysin Lyz {Bacteriophage P1 [TaxId: 10678]}
ggaicaiavmitivmgngnvrtnqaglelignaegcrrdpymcpagvwtdgignthgvtp
gvrktdqqiaadwekniliaercinqhfrgkdmpdnafsamtsaafnmgcnslrtyyska
rgmrvetsihkwaqkgewvnmcnhlpdfvnsngvplrglkirrekerqlcltglvneh

SCOP Domain Coordinates for d1xjta_:

Click to download the PDB-style file with coordinates for d1xjta_.
(The format of our PDB-style files is described here.)

Timeline for d1xjta_: