SCOPe 2.08: Domain d1xjta1: 1xjt A:9-185

Lineage for d1xjta1 (1xjt A:9-185)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.3: Phage lysozyme [53981] (4 proteins)

6. Protein Endolysin Lyz [117758] (1 species)

7. Species Bacteriophage P1 [TaxId:10678] [117759] (2 PDB entries)
   Uniprot Q37875 1-185

8. Domain d1xjta1: 1xjt A:9-185 [115393]
   Other proteins in same PDB: d1xjta2
   complexed with cit

Details for d1xjta1

PDB Entry: 1xjt, 1.75 Å

PDB Description: crystal structure of active form of p1 phage endolysin lyz

PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d1xjta1:

Sequence; same for both SEQRES and ATOM records:

>d1xjta1 d.2.1.3 (A:9-185) Endolysin Lyz {Bacteriophage P1 [TaxId: 10678]}
ggaicaiavmitivmgngnvrtnqaglelignaegcrrdpymcpagvwtdgignthgvtp
gvrktdqqiaadwekniliaercinqhfrgkdmpdnafsamtsaafnmgcnslrtyyska
rgmrvetsihkwaqkgewvnmcnhlpdfvnsngvplrglkirrekerqlcltglvne

Timeline for d1xjta1:

• d1xjta1 first appeared in SCOP 1.71, called d1xjta_
  
• d1xjta1 appears in SCOPe 2.07