PDB entry 1xjt

View 1xjt on RCSB PDB site
Description: Crystal structure of active form of P1 phage endolysin Lyz
Class: hydrolase
Keywords: open conformation, HYDROLASE
Deposited on 2004-09-24, released 2005-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Enterobacteria phage P1 [TaxId:10678]
    Gene: 17, LYSA, lyZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q37875 (Start-184)
      • modified residue (17)
      • modified residue (22)
      • modified residue (49)
      • modified residue (100)
      • modified residue (108)
      • modified residue (115)
      • modified residue (130)
      • modified residue (148)
      • expression tag (185)
    Domains in SCOPe 2.07: d1xjta1, d1xjta2
  • Heterogens: CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xjtA (A:)
    mkgktaagggaicaiavmitivmgngnvrtnqaglelignaegcrrdpymcpagvwtdgi
    gnthgvtpgvrktdqqiaadwekniliaercinqhfrgkdmpdnafsamtsaafnmgcns
    lrtyyskargmrvetsihkwaqkgewvnmcnhlpdfvnsngvplrglkirrekerqlclt
    glvnehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xjtA (A:)
    ggaicaiavmitivmgngnvrtnqaglelignaegcrrdpymcpagvwtdgignthgvtp
    gvrktdqqiaadwekniliaercinqhfrgkdmpdnafsamtsaafnmgcnslrtyyska
    rgmrvetsihkwaqkgewvnmcnhlpdfvnsngvplrglkirrekerqlcltglvneh