| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.224: SufE/NifU [82648] (1 superfamily) alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123 |
Superfamily d.224.1: SufE/NifU [82649] (4 families) ![]() iron-sulfur cluster assembly proteins |
| Family d.224.1.2: NifU/IscU domain [102928] (5 proteins) |
| Protein NifU [117910] (1 species) |
| Species Bacillus subtilis [TaxId:1423] [117911] (2 PDB entries) Uniprot O32163 |
| Domain d1xjsa_: 1xjs A: [115392] Structural genomics target complexed with zn |
PDB Entry: 1xjs (more details)
SCOPe Domain Sequences for d1xjsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xjsa_ d.224.1.2 (A:) NifU {Bacillus subtilis [TaxId: 1423]}
msfnanldtlyrqvimdhyknprnkgvlndsivvdmnnptcgdrirltmkldgdivedak
fegegcsismasasmmtqaikgkdietalsmskifsdmmqgkeyddsidlgdiealqgvs
kfparikcatlswkalekgvakeeggn
Timeline for d1xjsa_: