Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.1: AAT-like [53384] (17 proteins) |
Protein Putative alanine aminotransferase [117693] (1 species) |
Species Pyrococcus furiosus [TaxId:2261] [117694] (1 PDB entry) Uniprot Q9P9M8 |
Domain d1xi9c_: 1xi9 C: [115357] Other proteins in same PDB: d1xi9a2 Structural genomics target complexed with plp |
PDB Entry: 1xi9 (more details), 2.33 Å
SCOPe Domain Sequences for d1xi9c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xi9c_ c.67.1.1 (C:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} raskralsveyairdvvlparelekkgikvirlnigdpvkfdfqppehmkeayckaikeg hnyygdseglpelrkaiverekrkngvditpddvrvtaavtealqlifgalldpgdeilv pgpsyppytglvkfyggkpveyrtieeedwqpdiddirkkitdrtkaiavinpnnptgal ydkktleeilniageyeipvisdeiydlmtyegehispgsltkdvpvivmnglskvyfat gwrlgymyfvdpenklsevreaidrlarirlcpntpaqfaaiagltgpmdylkeymkklk errdyiykrlneipgisttkpqgafyifpkievgpwkndkefvldvlhnahvlfvhgsgf geygaghfravflppieileeamdrfekfmker
Timeline for d1xi9c_:
View in 3D Domains from other chains: (mouse over for more information) d1xi9a1, d1xi9a2, d1xi9b_, d1xi9d_ |