PDB entry 1xi9

View 1xi9 on RCSB PDB site
Description: Alanine aminotransferase from Pyrococcus furiosus Pfu-1397077-001
Class: transferase
Keywords: Alanine aminotransferase, Pyrococcus furiosus, Southeast Collaboratory for Structural Genomics, SECSG, hyperthermophile, protein structure initiative, PSI, transferase
Deposited on 2004-09-21, released 2004-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative transaminase
    Species: Pyrococcus furiosus [TaxId:186497]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9P9M8 (9-End)
      • expression tag (8)
    Domains in SCOPe 2.07: d1xi9a1, d1xi9a2
  • Chain 'B':
    Compound: putative transaminase
    Species: Pyrococcus furiosus [TaxId:186497]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi9b_
  • Chain 'C':
    Compound: putative transaminase
    Species: Pyrococcus furiosus [TaxId:186497]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi9c_
  • Chain 'D':
    Compound: putative transaminase
    Species: Pyrococcus furiosus [TaxId:186497]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi9d_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xi9A (A:)
    ahhhhhhgsiraskralsveyairdvvlparelekkgikvirlnigdpvkfdfqppehmk
    eayckaikeghnyygdseglpelrkaiverekrkngvditpddvrvtaavtealqlifga
    lldpgdeilvpgpsyppytglvkfyggkpveyrtieeedwqpdiddirkkitdrtkaiav
    inpnnptgalydkktleeilniageyeipvisdeiydlmtyegehispgsltkdvpvivm
    nglskvyfatgwrlgymyfvdpenklsevreaidrlarirlcpntpaqfaaiagltgpmd
    ylkeymkklkerrdyiykrlneipgisttkpqgafyifpkievgpwkndkefvldvlhna
    hvlfvhgsgfgeygaghfravflppieileeamdrfekfmkerlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xi9A (A:)
    siraskralsveyparelekkgikvirlnigdpvkfdfqppehmkeayckaikeghnyyg
    dseglpelrkaiverekrkngvditpddvrvtaavtealqlifgalldpgdeilvpgpsy
    ppytglvkfyggkpveyrtieeedwqpdiddirkkitdrtkaiavinpnnptgalydkkt
    leeilniageyeipvisdeiydlmtyegehispgsltkdvpvivmnglskvyfatgwrlg
    ymyfvdpenklsevreaidrlarirlcpntpaqfaaiagltgpmdylkeymkklkerrdy
    iykrlneipgisttkpqgafyifpkievgpwkndkefvldvlhnahvlfvhgsgfgeyga
    ghfravflppieileeamdrfekfmker
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xi9B (B:)
    ahhhhhhgsiraskralsveyairdvvlparelekkgikvirlnigdpvkfdfqppehmk
    eayckaikeghnyygdseglpelrkaiverekrkngvditpddvrvtaavtealqlifga
    lldpgdeilvpgpsyppytglvkfyggkpveyrtieeedwqpdiddirkkitdrtkaiav
    inpnnptgalydkktleeilniageyeipvisdeiydlmtyegehispgsltkdvpvivm
    nglskvyfatgwrlgymyfvdpenklsevreaidrlarirlcpntpaqfaaiagltgpmd
    ylkeymkklkerrdyiykrlneipgisttkpqgafyifpkievgpwkndkefvldvlhna
    hvlfvhgsgfgeygaghfravflppieileeamdrfekfmkerlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xi9B (B:)
    iraskralsveparelekkgikvirlnigdpvkfdfqppehmkeayckaikeghnyygds
    eglpelrkaiverekrkngvditpddvrvtaavtealqlifgalldpgdeilvpgpsypp
    ytglvkfyggkpveyrtieeedwqpdiddirkkitdrtkaiavinpnnptgalydkktle
    eilniageyeipvisdeiydlmtyegehispgsltkdvpvivmnglskvyfatgwrlgym
    yfvdpenklsevreaidrlarirlcpntpaqfaaiagltgpmdylkeymkklkerrdyiy
    krlneipgisttkpqgafyifpkievgpwkndkefvldvlhnahvlfvhgsgfgeygagh
    fravflppieileeamdrfekfmker
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xi9C (C:)
    ahhhhhhgsiraskralsveyairdvvlparelekkgikvirlnigdpvkfdfqppehmk
    eayckaikeghnyygdseglpelrkaiverekrkngvditpddvrvtaavtealqlifga
    lldpgdeilvpgpsyppytglvkfyggkpveyrtieeedwqpdiddirkkitdrtkaiav
    inpnnptgalydkktleeilniageyeipvisdeiydlmtyegehispgsltkdvpvivm
    nglskvyfatgwrlgymyfvdpenklsevreaidrlarirlcpntpaqfaaiagltgpmd
    ylkeymkklkerrdyiykrlneipgisttkpqgafyifpkievgpwkndkefvldvlhna
    hvlfvhgsgfgeygaghfravflppieileeamdrfekfmkerlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xi9C (C:)
    raskralsveyairdvvlparelekkgikvirlnigdpvkfdfqppehmkeayckaikeg
    hnyygdseglpelrkaiverekrkngvditpddvrvtaavtealqlifgalldpgdeilv
    pgpsyppytglvkfyggkpveyrtieeedwqpdiddirkkitdrtkaiavinpnnptgal
    ydkktleeilniageyeipvisdeiydlmtyegehispgsltkdvpvivmnglskvyfat
    gwrlgymyfvdpenklsevreaidrlarirlcpntpaqfaaiagltgpmdylkeymkklk
    errdyiykrlneipgisttkpqgafyifpkievgpwkndkefvldvlhnahvlfvhgsgf
    geygaghfravflppieileeamdrfekfmker
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xi9D (D:)
    ahhhhhhgsiraskralsveyairdvvlparelekkgikvirlnigdpvkfdfqppehmk
    eayckaikeghnyygdseglpelrkaiverekrkngvditpddvrvtaavtealqlifga
    lldpgdeilvpgpsyppytglvkfyggkpveyrtieeedwqpdiddirkkitdrtkaiav
    inpnnptgalydkktleeilniageyeipvisdeiydlmtyegehispgsltkdvpvivm
    nglskvyfatgwrlgymyfvdpenklsevreaidrlarirlcpntpaqfaaiagltgpmd
    ylkeymkklkerrdyiykrlneipgisttkpqgafyifpkievgpwkndkefvldvlhna
    hvlfvhgsgfgeygaghfravflppieileeamdrfekfmkerlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xi9D (D:)
    iraskralsveparelekkgikvirlnigdpvkfdfqppehmkeayckaikeghnyygds
    eglpelrkaiverekrkngvditpddvrvtaavtealqlifgalldpgdeilvpgpsypp
    ytglvkfyggkpveyrtieeedwqpdiddirkkitdrtkaiavinpnnptgalydkktle
    eilniageyeipvisdeiydlmtyegehispgsltkdvpvivmnglskvyfatgwrlgym
    yfvdpenklsevreaidrlarirlcpntpaqfaaiagltgpmdylkeymkklkerrdyiy
    krlneipgisttkpqgafyifpkievgpwkndkefvldvlhnahvlfvhgsgfgeygagh
    fravflppieileeamdrfekfmker