SCOPe 2.02: Domain d1xhxa2: 1xhx A:188-575

Lineage for d1xhxa2 (1xhx A:188-575)

1. Root: SCOPe 2.02

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.1: DNA polymerase I [56673] (4 proteins)

6. Protein phi29 DNA polymerase [118193] (1 species)

7. Species Bacteriophage phi-29 [TaxId:10756] [118194] (8 PDB entries)
   Uniprot P03680

8. Domain d1xhxa2: 1xhx A:188-575 [115306]
   Other proteins in same PDB: d1xhxa1
   complexed with mg, so4

Details for d1xhxa2

PDB Entry: 1xhx, 2.35 Å

PDB Description: phi29 dna polymerase, orthorhombic crystal form

PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d1xhxa2:

Sequence; same for both SEQRES and ATOM records:

>d1xhxa2 e.8.1.1 (A:188-575) phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 10756]}
mtagsdslkgfkdiittkkfkkvfptlslgldkevryayrggftwlndrfkekeigegmv
fdvnslypaqmysrllpygepivfegkyvwdedyplhiqhircefelkegyiptiqikrs
rfykgneylkssggeiadlwlsnvdlelmkehydlynveyisglkfkattglfkdfidkw
tyikttsegaikqlaklmlnslygkfasnpdvtgkvpylkengalgfrlgeeetkdpvyt
pmgvfitawaryttitaaqacydriiycdtdsihltgteipdvikdivdpkklgywahes
tfkrakylrqktyiqdiymkevdgklvegspddytdikfsvkcagmtdkikkevtfenfk
vgfsrkmkpkpvqvpggvvlvddtftik

Timeline for d1xhxa2:

• d1xhxa2 first appeared in SCOP 1.71
  
• d1xhxa2 appears in SCOPe 2.01
  
• d1xhxa2 appears in SCOPe 2.03
  
• d1xhxa2 appears in the current release, SCOPe 2.08