Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.5: Type II chitinase [51534] (15 proteins) glycosylase family 18 |
Protein Signal processing protein (SPC-40, MGP-40) [89480] (5 species) secreted during involution |
Species Pig (Sus scrofa) [TaxId:9823] [117369] (4 PDB entries) Uniprot Q5UC99 |
Domain d1xhga1: 1xhg A:1-239,A:308-361 [115296] Other proteins in same PDB: d1xhga2 |
PDB Entry: 1xhg (more details), 2.9 Å
SCOPe Domain Sequences for d1xhga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xhga1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Pig (Sus scrofa) [TaxId: 9823]} yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln tlknrnpnlktllsvggwnfgpqrfskiasktqsrrtfiksvppflrthgfdgldlawly pgrrdkrhlttlvkemkaefireaqagteqlllsaavsagkiaidrgydiaqisrhldfi slltydfhgawrqtvghhsplfrgqedassrfsnadyavsymlrlgapanklvmgiptXd dqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlar
Timeline for d1xhga1: