Lineage for d1xhga1 (1xhg A:1-239,A:308-361)
- Root: SCOP 1.71
Class c: Alpha and beta proteins (a/b) [51349] (134 folds) Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (13 families) 
Family c.1.8.5: Type II chitinase [51534] (14 proteins)
glycosylase family 18
Protein Signal processing protein (SPC-40, MGP-40) [89480] (5 species)
secreted during involution
Species Pig (Sus scrofa) [TaxId:9823] [117369] (2 PDB entries) 
Domain d1xhga1: 1xhg A:1-239,A:308-361 [115296]
Other proteins in same PDB: d1xhga2
complexed with nag
Details for d1xhga1
PDB Entry: 1xhg (more details), 2.9 Å
PDB Description: crystal structure of a 40 kda signalling protein from porcine (spp-40) at 2.89a resolution
SCOP Domain Sequences for d1xhga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xhga1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Pig (Sus scrofa)}
yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
tlknrnpnlktllsvggwnfgpqrfskiasktqsrrtfiksvppflrthgfdgldlawly
pgrrdkrhlttlvkemkaefireaqagteqlllsaavsagkiaidrgydiaqisrhldfi
slltydfhgawrqtvghhsplfrgqedassrfsnadyavsymlrlgapanklvmgiptXd
dqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlar
SCOP Domain Coordinates for d1xhga1:
Click to download the PDB-style file with coordinates for d1xhga1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xhga1:
- d1xhga1 is new in SCOP 1.71
- d1xhga1 appears in SCOP 1.73
- d1xhga1 appears in the current release, SCOPe 2.08
View in 3D
