SCOPe 2.08: Domain d1xh3a2: 1xh3 A:1-181

Lineage for d1xh3a2 (1xh3 A:1-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-B35 [TaxId:9606] [54475] (16 PDB entries)
   Uniprot P30685 25-300

8. Domain d1xh3a2: 1xh3 A:1-181 [115288]
   Other proteins in same PDB: d1xh3a1, d1xh3b_

Details for d1xh3a2

PDB Entry: 1xh3, 1.48 Å

PDB Description: Conformational Restraints and Flexibility of 14-Meric Peptides in Complex with HLA-B*3501

PDB Compounds: (A:) HLA class I histocompatibility antigen, B-35 alpha chain

SCOPe Domain Sequences for d1xh3a2:

Sequence; same for both SEQRES and ATOM records:

>d1xh3a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B35 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw
drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq
r

Timeline for d1xh3a2:

• d1xh3a2 first appeared in SCOP 1.71
  
• d1xh3a2 appears in SCOPe 2.07