SCOPe 2.01: Domain d1xfdb2: 1xfd B:592-849

Lineage for d1xfdb2 (1xfd B:592-849)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
   N-terminal domain is a 8-bladed beta-propeller

6. Protein Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain [117705] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117706] (1 PDB entry)
   Uniprot P42658 127-849

8. Domain d1xfdb2: 1xfd B:592-849 [115254]
   Other proteins in same PDB: d1xfda1, d1xfdb1, d1xfdc1, d1xfdd1

Details for d1xfdb2

PDB Entry: 1xfd, 3 Å

PDB Description: structure of a human a-type potassium channel accelerating factor dppx, a member of the dipeptidyl aminopeptidase family

PDB Compounds: (B:) Dipeptidyl aminopeptidase-like protein 6

SCOPe Domain Sequences for d1xfdb2:

Sequence; same for both SEQRES and ATOM records:

>d1xfdb2 c.69.1.24 (B:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
pkveyrdieiddynlpmqilkpatftdtthyplllvvdgtpgsqsvaekfevswetvmvs
shgavvvkcdgrgsgfqgtkllhevrrrlglleekdqmeavrtmlkeqyidrtrvavfgk
dyggylstyilpakgenqgqtftcgsalspitdfklyasafserylglhgldnrayemtk
vahrvsaleeqqfliihptadekihfqhtaelitqlirgkanyslqiypdeshyftsssl
kqhlyrsiinffvecfri

Timeline for d1xfdb2:

• d1xfdb2 first appeared in SCOP 1.71
  
• d1xfdb2 appears in SCOP 1.75
  
• d1xfdb2 appears in SCOPe 2.02
  
• d1xfdb2 appears in the current release, SCOPe 2.08