SCOPe 2.07: Domain d1xeyb_: 1xey B:

Lineage for d1xeyb_ (1xey B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.6: Pyridoxal-dependent decarboxylase [69565] (4 proteins)
   automatically mapped to Pfam PF00282

6. Protein Glutamate decarboxylase alpha, GadA [117695] (1 species)

7. Species Escherichia coli [TaxId:562] [117696] (1 PDB entry)
   Uniprot P69908

8. Domain d1xeyb_: 1xey B: [115238]
   complexed with act, gua, plp

Details for d1xeyb_

PDB Entry: 1xey, 2.05 Å

PDB Description: Crystal structure of the complex of Escherichia coli GADA with glutarate at 2.05 A resolution

PDB Compounds: (B:) Glutamate decarboxylase alpha

SCOPe Domain Sequences for d1xeyb_:

Sequence; same for both SEQRES and ATOM records:

>d1xeyb_ c.67.1.6 (B:) Glutamate decarboxylase alpha, GadA {Escherichia coli [TaxId: 562]}
klltdfrselldsrfgakaistiaeskrfplhemrddvafqiindelyldgnarqnlatf
cqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtnt
igsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipmr
pgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhid
aasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfnv
dylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgpy
efictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmri
mcrrgfemdfaellledykaslkylsdhp

Timeline for d1xeyb_:

• d1xeyb_ first appeared in SCOP 1.71
  
• d1xeyb_ appears in SCOPe 2.06
  
• d1xeyb_ appears in the current release, SCOPe 2.08