SCOP 1.73: Domain d1xedc_: 1xed C:

Lineage for d1xedc_ (1xed C:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Polymeric-immunoglobulin receptor, PIGR [117038] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117039] (1 PDB entry)

8. Domain d1xedc_: 1xed C: [115231]

Details for d1xedc_

PDB Entry: 1xed, 1.9 Å

PDB Description: Crystal Structure of a Ligand-Binding Domain of the Human Polymeric Ig Receptor, pIgR

PDB Compounds: (C:) Polymeric-immunoglobulin receptor

SCOP Domain Sequences for d1xedc_:

Sequence, based on SEQRES records:

>d1xedc_ b.1.1.1 (C:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]}
pifgpeevnsvegnsvsitcyypptsvnrhtrkywcrqgarggcitlissegyvsskyag
ranltnfpengtfvvniaqlsqddsgrykcglginsrglsfdvslevleh

Sequence, based on observed residues (ATOM records):

>d1xedc_ b.1.1.1 (C:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]}
pifgpeevnsvegnsvsitcyypptsvnrhtrkywcrqcitlissegyvsskyagranlt
nfpengtfvvniaqlsqddsgrykcglginsrglsfdvslevleh

Timeline for d1xedc_:

• d1xedc_ first appeared in SCOP 1.71
  
• d1xedc_ appears in SCOP 1.75
  
• d1xedc_ appears in the current release, SCOPe 2.08, called d1xedc1