SCOPe 2.07: Domain d1xecb_: 1xec B:

Lineage for d1xecb_ (1xec B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.7: Ngr ectodomain-like [75142] (7 proteins)
   this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain

6. Protein Decorin [117463] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [117464] (3 PDB entries)
   Uniprot P21793 52-356

8. Domain d1xecb_: 1xec B: [115228]
   complexed with nag

Details for d1xecb_

PDB Entry: 1xec, 2.3 Å

PDB Description: dimeric bovine tissue-extracted decorin, crystal form 2

PDB Compounds: (B:) Decorin

SCOPe Domain Sequences for d1xecb_:

Sequence; same for both SEQRES and ATOM records:

>d1xecb_ c.10.2.7 (B:) Decorin {Cow (Bos taurus) [TaxId: 9913]}
gpvcpfrcqchlrvvqcsdlglekvpkdlppdtalldlqnnkiteikdgdfknlknlhtl
ilinnkiskispgafaplvklerlylsknqlkelpekmpktlqelrvheneitkvrksvf
nglnqmivvelgtnplkssgiengafqgmkklsyiriadtnittipqglppsltelhldg
nkitkvdaaslkglnnlaklglsfnsisavdngslantphlrelhlnnnklvkvpgglad
hkyiqvvylhnnnisaigsndfcppgyntkkasysgvslfsnpvqyweiqpstfrcvyvr
aavql

Timeline for d1xecb_:

• d1xecb_ first appeared in SCOP 1.71
  
• d1xecb_ appears in SCOPe 2.06
  
• d1xecb_ appears in the current release, SCOPe 2.08