Class b: All beta proteins [48724] (180 folds) |
Fold b.78: beta-Prism II [51109] (1 superfamily) consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis duplication: consists of two domains of this fold |
Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families) |
Family b.78.1.1: alpha-D-mannose-specific plant lectins [51111] (4 proteins) |
Protein Gastrodianin (antifungal protein) [117304] (1 species) |
Species Gastrodia elata [TaxId:91201] [117305] (2 PDB entries) Uniprot Q9AXZ2 29-140 # different isoforms |
Domain d1xd5c_: 1xd5 C: [115157] complexed with so4 |
PDB Entry: 1xd5 (more details), 2 Å
SCOPe Domain Sequences for d1xd5c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xd5c_ b.78.1.1 (C:) Gastrodianin (antifungal protein) {Gastrodia elata [TaxId: 91201]} sdrlnsghqldtggslaeggylfiiqndcnlvlydnnravwasgtngkasgcvlkmqndg nlviysgsraiwasntnrqngnyylilqrdrnvviydnsnnaiwathtnvg
Timeline for d1xd5c_: