Lineage for d1xd5d_ (1xd5 D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813364Fold b.78: beta-Prism II [51109] (1 superfamily)
    consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis
    duplication: consists of two domains of this fold
  4. 2813365Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families) (S)
  5. 2813366Family b.78.1.1: alpha-D-mannose-specific plant lectins [51111] (4 proteins)
  6. 2813381Protein Gastrodianin (antifungal protein) [117304] (1 species)
  7. 2813382Species Gastrodia elata [TaxId:91201] [117305] (2 PDB entries)
    Uniprot Q9AXZ2 29-140 # different isoforms
  8. 2813386Domain d1xd5d_: 1xd5 D: [115158]
    complexed with so4

Details for d1xd5d_

PDB Entry: 1xd5 (more details), 2 Å

PDB Description: Crystal structures of novel monomeric monocot mannose-binding lectins from Gastrodia elata
PDB Compounds: (D:) antifungal protein GAFP-1

SCOPe Domain Sequences for d1xd5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xd5d_ b.78.1.1 (D:) Gastrodianin (antifungal protein) {Gastrodia elata [TaxId: 91201]}
sdrlnsghqldtggslaeggylfiiqndcnlvlydnnravwasgtngkasgcvlkmqndg
nlviysgsraiwasntnrqngnyylilqrdrnvviydnsnnaiwathtnv

SCOPe Domain Coordinates for d1xd5d_:

Click to download the PDB-style file with coordinates for d1xd5d_.
(The format of our PDB-style files is described here.)

Timeline for d1xd5d_: