SCOPe 2.08: Domain d1xb8a_: 1xb8 A:

Lineage for d1xb8a_ (1xb8 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Azurin [49530] (6 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [49533] (96 PDB entries)
   Uniprot P00282

8. Domain d1xb8a_: 1xb8 A: [115064]
   complexed with zn; mutant

Details for d1xb8a_

PDB Entry: 1xb8, 2 Å

PDB Description: zn substituted form of d62c/k74c double mutant of pseudomonas aeruginosa azurin

PDB Compounds: (A:) Azurin

SCOPe Domain Sequences for d1xb8a_:

Sequence; same for both SEQRES and ATOM records:

>d1xb8a_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
ecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvvt
cgmasgldkdylcpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsalm
kgtltlk

Timeline for d1xb8a_:

• d1xb8a_ first appeared in SCOP 1.71
  
• d1xb8a_ appears in SCOPe 2.07