PDB entry 1xb8

View 1xb8 on RCSB PDB site
Description: Zn substituted form of D62C/K74C double mutant of Pseudomonas Aeruginosa Azurin
Class: electron transport
Keywords: Azurin; Electron Transport; Thermostability; Mutant, ELECTRON TRANSPORT
Deposited on 2004-08-30, released 2004-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (Start-127)
      • engineered (61)
      • engineered (73)
    Domains in SCOPe 2.07: d1xb8a_
  • Chain 'C':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (Start-127)
      • engineered (61)
      • engineered (73)
    Domains in SCOPe 2.07: d1xb8c_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xb8A (A:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tcgmasgldkdylcpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xb8A (A:)
    ecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvvt
    cgmasgldkdylcpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsalm
    kgtltlk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xb8C (C:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tcgmasgldkdylcpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xb8C (C:)
    csvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvvtc
    gmasgldkdylcpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsalmk
    gtltlk