Lineage for d1x7wb2 (1x7w B:205-342)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 993790Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 993791Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) (S)
  5. 993843Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (4 proteins)
  6. 993851Protein Branched-chain alpha-keto acid dehydrogenase [52927] (2 species)
  7. 993852Species Human (Homo sapiens) [TaxId:9606] [52928] (21 PDB entries)
    Uniprot P21953 52-392
  8. 993858Domain d1x7wb2: 1x7w B:205-342 [114940]
    Other proteins in same PDB: d1x7wa_, d1x7wb1
    complexed with cl, gol, k, mn, tdp

Details for d1x7wb2

PDB Entry: 1x7w (more details), 1.73 Å

PDB Description: crystal structure of the human mitochondrial branched-chain alpha- ketoacid dehydrogenase
PDB Compounds: (B:) 2-oxoisovalerate dehydrogenase beta subunit

SCOPe Domain Sequences for d1x7wb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x7wb2 c.48.1.2 (B:205-342) Branched-chain alpha-keto acid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
pyniplsqaeviqegsdvtlvawgtqvhvirevasmakeklgvscevidlrtiipwdvdt
icksviktgrllisheapltggfaseisstvqeecflnleapisrvcgydtpfphifepf
yipdkwkcydalrkminy

SCOPe Domain Coordinates for d1x7wb2:

Click to download the PDB-style file with coordinates for d1x7wb2.
(The format of our PDB-style files is described here.)

Timeline for d1x7wb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1x7wb1
View in 3D
Domains from other chains:
(mouse over for more information)
d1x7wa_