Lineage for d1wtyc_ (1wty C:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637916Fold a.24: Four-helical up-and-down bundle [47161] (27 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 638308Superfamily a.24.16: Nucleotidyltransferase substrate binding subunit/domain [81593] (4 families) (S)
  5. 638316Family a.24.16.2: Family 1 bi-partite nucleotidyltransferase subunit [81740] (2 proteins)
  6. 638323Protein Probable nucleotidyltransferase subunit TTHA0048 [116876] (1 species)
  7. 638324Species Thermus thermophilus [TaxId:274] [116877] (1 PDB entry)
    Structural genomics target
  8. 638327Domain d1wtyc_: 1wty C: [114882]

Details for d1wtyc_

PDB Entry: 1wty (more details), 2.2 Å

PDB Description: Crystal structure of a probable nucleotidyl transferase protein from thermus thermophilus HB8
PDB Compounds: (C:) hypothetical protein TTHA0048

SCOP Domain Sequences for d1wtyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wtyc_ a.24.16.2 (C:) Probable nucleotidyltransferase subunit TTHA0048 {Thermus thermophilus [TaxId: 274]}
aslaraverlkaalerpkdefirdsaiqrfeftfelawktlktflelqglearspraair
gafqvgllpedpfwlemlelrnltnhtydealaeriyaelpkalerfqellrrle

SCOP Domain Coordinates for d1wtyc_:

Click to download the PDB-style file with coordinates for d1wtyc_.
(The format of our PDB-style files is described here.)

Timeline for d1wtyc_: