SCOPe 2.06: Domain d1wsjd_: 1wsj D:

Lineage for d1wsjd_ (1wsj D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein RNase H (RNase HI) [53100] (4 species)

7. Species Escherichia coli [TaxId:562] [53101] (33 PDB entries)
   Uniprot P0A7Y4

8. Domain d1wsjd_: 1wsj D: [114860]
   mutant

Details for d1wsjd_

PDB Entry: 1wsj, 2 Å

PDB Description: crystal structure of e.coli rnase hi active site mutant (k87a/h124a)

PDB Compounds: (D:) ribonuclease hi

SCOPe Domain Sequences for d1wsjd_:

Sequence, based on SEQRES records:

>d1wsjd_ c.55.3.1 (D:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]}
mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealk
ehcevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwew
vkgaaghpenercdelaraaamnptledtgyqv

Sequence, based on observed residues (ATOM records):

>d1wsjd_ c.55.3.1 (D:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]}
mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealk
ehcevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwew
vghpenercdelaraaamnptledtgyqv

Timeline for d1wsjd_:

• d1wsjd_ first appeared in SCOP 1.71
  
• d1wsjd_ appears in SCOPe 2.05
  
• d1wsjd_ appears in SCOPe 2.07
  
• d1wsjd_ appears in the current release, SCOPe 2.08