| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.233: YfbU-like [116959] (1 superfamily) multihelical; consist of two subdomains; forms 24-mer with the N-terminal sudbomains packing around the 4-fold axis and the C-terminal domains interacting at the 2-fold and 3-fold axes |
Superfamily a.233.1: YfbU-like [116960] (1 family) ![]() automatically mapped to Pfam PF03887 |
| Family a.233.1.1: YfbU-like [116961] (2 proteins) Pfam PF03887 |
| Protein Hypothetical protein YfbU [116962] (1 species) |
| Species Escherichia coli [TaxId:562] [116963] (1 PDB entry) Uniprot P0A8W8 |
| Domain d1wpbg_: 1wpb G: [114789] Structural genomics target complexed with cl, gol |
PDB Entry: 1wpb (more details), 2 Å
SCOPe Domain Sequences for d1wpbg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wpbg_ a.233.1.1 (G:) Hypothetical protein YfbU {Escherichia coli [TaxId: 562]}
qestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefgelke
etcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvnvegr
ythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina
Timeline for d1wpbg_: