SCOP 1.71: Domain d1wp6a2: 1wp6 A:5-398

Lineage for d1wp6a2 (1wp6 A:5-398)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (13 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Bacterial alpha-amylase [51447] (8 species)

7. Species Bacillus sp. strain 707 [117366] (2 PDB entries)

8. Domain d1wp6a2: 1wp6 A:5-398 [114782]
   Other proteins in same PDB: d1wp6a1
   complexed with ca, na, po4, trs

Details for d1wp6a2

PDB Entry: 1wp6, 2.1 Å

PDB Description: Crystal structure of maltohexaose-producing amylase from alkalophilic Bacillus sp.707.

SCOP Domain Sequences for d1wp6a2:

Sequence; same for both SEQRES and ATOM records:

>d1wp6a2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. strain 707}
tngtmmqyfewylpndgnhwnrlnsdasnlkskgitavwippawkgasqndvgygaydly
dlgefnqkgtvrtkygtrsqlqaavtslknngiqvygdvvmnhkggadatemvravevnp
nnrnqevtgeytieawtrfdfpgrgnthssfkwrwyhfdgvdwdqsrrlnnriykfrghg
kawdwevdtengnydylmyadidmdhpevvnelrnwgvwytntlgldgfridavkhikys
ftrdwinhvrsatgknmfavaefwkndlgaienylqktnwnhsvfdvplhynlynasksg
gnydmrnifngtvvqrhpshavtfvdnhdsqpeealesfveewfkplayaltltreqgyp
svfygdyygipthgvpamrskidpilearqkyay

Timeline for d1wp6a2:

• d1wp6a2 is new in SCOP 1.71
  
• d1wp6a2 appears in SCOP 1.73
  
• d1wp6a2 appears in the current release, SCOPe 2.08