SCOPe 2.01: Domain d1wnwb_: 1wnw B:

Lineage for d1wnwb_ (1wnw B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)

6. Protein Heme oxygenase HmuO [89159] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [89160] (12 PDB entries)
   Uniprot P71119

8. Domain d1wnwb_: 1wnw B: [114766]
   complexed with hem, iod, na, so4; mutant

Details for d1wnwb_

PDB Entry: 1wnw, 1.7 Å

PDB Description: d136n mutant of heme oxygenase from corynebacterium diphtheriae (hmuo)

PDB Compounds: (B:) Heme oxygenase

SCOPe Domain Sequences for d1wnwb_:

Sequence; same for both SEQRES and ATOM records:

>d1wnwb_ a.132.1.1 (B:) Heme oxygenase HmuO {Corynebacterium diphtheriae [TaxId: 1717]}
aglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavra
sgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpal
vahhyvrylgnlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlel
sdeqrehllkeatdafvfnhqvfadlgkgl

Timeline for d1wnwb_:

• d1wnwb_ first appeared in SCOP 1.71
  
• d1wnwb_ appears in SCOP 1.75
  
• d1wnwb_ appears in SCOPe 2.02
  
• d1wnwb_ appears in the current release, SCOPe 2.08