SCOPe 2.04: Domain d1wnvc_: 1wnv C:

Lineage for d1wnvc_ (1wnv C:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
   automatically mapped to Pfam PF01126

6. Protein Heme oxygenase HmuO [89159] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [89160] (16 PDB entries)
   Uniprot P71119

8. Domain d1wnvc_: 1wnv C: [114764]
   complexed with hem, so4; mutant

Details for d1wnvc_

PDB Entry: 1wnv, 1.85 Å

PDB Description: d136a mutant of heme oxygenase from corynebacterium diphtheriae (hmuo)

PDB Compounds: (C:) Heme oxygenase

SCOPe Domain Sequences for d1wnvc_:

Sequence; same for both SEQRES and ATOM records:

>d1wnvc_ a.132.1.1 (C:) Heme oxygenase HmuO {Corynebacterium diphtheriae [TaxId: 1717]}
glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
ahhyvrylgalsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
deqrehllkeatdafvfnhqvfadlgk

Timeline for d1wnvc_:

• d1wnvc_ first appeared in SCOP 1.71
  
• d1wnvc_ appears in SCOPe 2.03
  
• d1wnvc_ appears in SCOPe 2.05
  
• d1wnvc_ appears in the current release, SCOPe 2.08