Lineage for d1wnvc_ (1wnv C:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1098898Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 1098899Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 1098900Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
  6. 1098904Protein Heme oxygenase HmuO [89159] (1 species)
  7. 1098905Species Corynebacterium diphtheriae [TaxId:1717] [89160] (12 PDB entries)
    Uniprot P71119
  8. 1098933Domain d1wnvc_: 1wnv C: [114764]
    complexed with hem, so4; mutant

Details for d1wnvc_

PDB Entry: 1wnv (more details), 1.85 Å

PDB Description: d136a mutant of heme oxygenase from corynebacterium diphtheriae (hmuo)
PDB Compounds: (C:) Heme oxygenase

SCOPe Domain Sequences for d1wnvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wnvc_ a.132.1.1 (C:) Heme oxygenase HmuO {Corynebacterium diphtheriae [TaxId: 1717]}
glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
ahhyvrylgalsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
deqrehllkeatdafvfnhqvfadlgk

SCOPe Domain Coordinates for d1wnvc_:

Click to download the PDB-style file with coordinates for d1wnvc_.
(The format of our PDB-style files is described here.)

Timeline for d1wnvc_: