SCOP 1.71: Domain d1wnrb_: 1wnr B:

Lineage for d1wnrb_ (1wnr B:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (2 families)

5. Family b.35.1.1: GroES [50130] (2 proteins)

6. Protein Chaperonin-10 (GroES) [50131] (4 species)

7. Species Thermus thermophilus [TaxId:274] [110172] (3 PDB entries)

8. Domain d1wnrb_: 1wnr B: [114756]

Details for d1wnrb_

PDB Entry: 1wnr, 2.9 Å

PDB Description: Crystal structure of the Cpn10 from Thermus thermophilus HB8

SCOP Domain Sequences for d1wnrb_:

Sequence, based on SEQRES records:

>d1wnrb_ b.35.1.1 (B:) Chaperonin-10 (GroES) {Thermus thermophilus}
mikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplevke
gdivvfakyggteieidgeeyvilserdllavlq

Sequence, based on observed residues (ATOM records):

>d1wnrb_ b.35.1.1 (B:) Chaperonin-10 (GroES) {Thermus thermophilus}
mikplgdrvvvkripqkgkviavgtgrvlengqrvplevkegdivvfakyggteieidge
eyvilserdllavlq

Timeline for d1wnrb_:

• d1wnrb_ is new in SCOP 1.71
  
• d1wnrb_ appears in SCOP 1.73
  
• d1wnrb_ appears in the current release, SCOPe 2.08