PDB entry 1wnr

View 1wnr on RCSB PDB site
Description: Crystal structure of the Cpn10 from Thermus thermophilus HB8
Deposited on 2004-08-09, released 2004-12-07
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-07, with a file datestamp of 2004-12-07.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.253
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1wnra_
  • Chain 'B':
    Domains in SCOP 1.71: d1wnrb_
  • Chain 'C':
    Domains in SCOP 1.71: d1wnrc_
  • Chain 'D':
    Domains in SCOP 1.71: d1wnrd_
  • Chain 'E':
    Domains in SCOP 1.71: d1wnre_
  • Chain 'F':
    Domains in SCOP 1.71: d1wnrf_
  • Chain 'G':
    Domains in SCOP 1.71: d1wnrg_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wnrA (A:)
    mikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplevke
    gdivvfakyggteieidgeeyvilserdllavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wnrA (A:)
    mikplgdrvvvkripqkgkviavgtgrvlengqrvplevkegdivvfakyggteieidge
    eyvilserdllavlq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wnrB (B:)
    mikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplevke
    gdivvfakyggteieidgeeyvilserdllavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wnrB (B:)
    mikplgdrvvvkripqkgkviavgtgrvlengqrvplevkegdivvfakyggteieidge
    eyvilserdllavlq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wnrC (C:)
    mikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplevke
    gdivvfakyggteieidgeeyvilserdllavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wnrC (C:)
    mikplgdrvvvkrivlpdtakekpqkgkviavgtgrvlengqrvplevkegdivvfakyg
    gteieidgeeyvilserdllavlq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wnrD (D:)
    mikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplevke
    gdivvfakyggteieidgeeyvilserdllavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wnrD (D:)
    mikplgdrvvvkripqkgkviavgtgrvlengqrvplevkegdivvfakyggteieidge
    eyvilserdllavlq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1wnrE (E:)
    mikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplevke
    gdivvfakyggteieidgeeyvilserdllavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wnrE (E:)
    mikplgdrvvvkripqkgkviavgtgrvlengqrvplevkegdivvfakyggteieidge
    eyvilserdllavlq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1wnrF (F:)
    mikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplevke
    gdivvfakyggteieidgeeyvilserdllavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wnrF (F:)
    mikplgdrvvvkripqkgkviavgtgrvlengqrvplevkegdivvfakyggteieidge
    eyvilserdllavlq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1wnrG (G:)
    mikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplevke
    gdivvfakyggteieidgeeyvilserdllavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wnrG (G:)
    mikplgdrvvvkrieeepktkggivpqkgkviavgtgrvlengqrvplevkegdivvfak
    yggteieidgeeyvilserdllavlq