Lineage for d1wnbb_ (1wnb B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2157920Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2157921Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2157922Family c.82.1.1: ALDH-like [53721] (6 proteins)
  6. 2158234Protein Putative betaine aldehyde dehydrogenase YdcW [117733] (1 species)
  7. 2158235Species Escherichia coli [TaxId:562] [117734] (2 PDB entries)
    Uniprot P77674
  8. 2158241Domain d1wnbb_: 1wnb B: [114748]
    complexed with btl, nai

Details for d1wnbb_

PDB Entry: 1wnb (more details), 2.2 Å

PDB Description: Escherichia coli YdcW gene product is a medium-chain aldehyde dehydrogenase (complexed with nadh and betaine aldehyde)
PDB Compounds: (B:) Putative betaine aldehyde dehydrogenase

SCOPe Domain Sequences for d1wnbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wnbb_ c.82.1.1 (B:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]}
mqhkllingelvsgegekqpvynpatgdvlleiaeasaeqvdaavraadaafaewgqttp
kvraecllkladvieengqvfaelesrncgkplhsafndeipaivdvfrffagaarclng
laageyleghtsmirrdplgvvasiapwnyplmmaawklapalaagncvvlkpseitplt
alklaelakdifpagvvnilfgrgktvgdpltghpkvrmvsltgsiatgehiishtassi
krthmelggkapvivfddadieavvegvrtfgyynagqdctaacriyaqkgiydtlvekl
gaavatlksgapddestelgplsslahlervgkaveeakatghikvitggekrkgngyyy
aptllagalqddaivqkevfgpvvsvtpfdneeqvvnwandsqyglassvwtkdvgrahr
vsarlqygctwvnthfmlvsemphggqklsgygkdmslygledytvvrhvmvkh

SCOPe Domain Coordinates for d1wnbb_:

Click to download the PDB-style file with coordinates for d1wnbb_.
(The format of our PDB-style files is described here.)

Timeline for d1wnbb_: