![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
![]() | Protein Probable acetyltransferase TTHA1209 [118068] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [118069] (2 PDB entries) Uniprot Q5SJ05 |
![]() | Domain d1wk4c_: 1wk4 C: [114723] Structural genomics target complexed with mes |
PDB Entry: 1wk4 (more details), 2.8 Å
SCOPe Domain Sequences for d1wk4c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wk4c_ d.108.1.1 (C:) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]} vrirragledlpgvarvlvdtwratyrgvvpeafleglsyegqaerwaqrlktptwpgrl fvaesesgevvgfaafgpdrasgfpgytaelwaiyvlptwqrkglgralfhegarllqae gygrmlvwvlkenpkgrgfyehlggvllgereielggaklwevaygfdlgghkw
Timeline for d1wk4c_: