![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
![]() | Family c.26.2.4: Universal stress protein-like [52436] (8 proteins) Pfam PF00582 |
![]() | Protein Hypothetical protein TTHA0895 [117487] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [117488] (1 PDB entry) Uniprot Q5SJV7 |
![]() | Domain d1wjga_: 1wjg A: [114696] Structural genomics target |
PDB Entry: 1wjg (more details), 2.1 Å
SCOPe Domain Sequences for d1wjga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wjga_ c.26.2.4 (A:) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} fktillaydgseharraaevakaeaeahgarlivvhayepvpdylgepffeealrrrler aegvleearaltgvpkedalllegvpaeailqaaraekadlivmgtrglgalgslflgsq sqrvvaeapcpvllv
Timeline for d1wjga_: